Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fur protein

This E. coli fur protein spans the amino acid sequence from region 2-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ferric uptake regulator

UniProt

P0A9A9

Expression Region

2-148aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plekhf2 Antibody
orb860821 2 mg

Plekhf2 Antibody

Sign In for Pricing
View Details
Fam220a (NM_026050) Mouse Tagged ORF Clone
MG215241 10 µg

Fam220a (NM_026050) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SUSD4 Polyclonal Antibody
A61206-100 100 µL

SUSD4 Polyclonal Antibody

Sign In for Pricing
View Details
Coq6 Mouse siRNA Oligo Duplex (Locus ID 217707)
SR415400 1 Kit

Coq6 Mouse siRNA Oligo Duplex (Locus ID 217707)

Sign In for Pricing
View Details
6- (6-Aminohexanamido) hexanoic acid
OR90472-01 250 mg

6- (6-Aminohexanamido) hexanoic acid

Sign In for Pricing
View Details
6- (6-Aminohexanamido) hexanoic acid
OR90472-02 1 g

6- (6-Aminohexanamido) hexanoic acid

Sign In for Pricing
View Details