Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Fetub protein

This Rat Fetub protein spans the amino acid sequence from region 19-378aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fetuin-like protein IRL685

UniProt

Q9QX79

Expression Region

19-378aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OGFRL1 Protein Vector (Mouse) (pPM-C-HA)
PV207788 500 ng

OGFRL1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
miRZip-203 anti-miR-203 microRNA construct
MZIP203-PA-1 Bacterial Streak

miRZip-203 anti-miR-203 microRNA construct

Sign In for Pricing
View Details
Monkey Ankyrin repeat domain containing protein 62 (ANKRD62) ELISA Kit
GTR10365046 96 Well

Monkey Ankyrin repeat domain containing protein 62 (ANKRD62) ELISA Kit

Sign In for Pricing
View Details
THRA Polyclonal Antibody
MBS9127174-01 0.02 mL

THRA Polyclonal Antibody

Sign In for Pricing
View Details
THRA Polyclonal Antibody
MBS9127174-02 0.1 mL

THRA Polyclonal Antibody

Sign In for Pricing
View Details
THRA Polyclonal Antibody
MBS9127174-03 5x 0.1 mL

THRA Polyclonal Antibody

Sign In for Pricing
View Details