Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Fetub protein

This Rat Fetub protein spans the amino acid sequence from region 19-378aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fetuin-like protein IRL685

UniProt

Q9QX79

Expression Region

19-378aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4-D Butyl ester (Standard)
HY-B0867R-01 10 mg

2,4-D Butyl ester (Standard)

Sign In for Pricing
View Details
2,4-D Butyl ester (Standard)
HY-B0867R-02 25 mg

2,4-D Butyl ester (Standard)

Sign In for Pricing
View Details
2,4-D Butyl ester (Standard)
HY-B0867R-03 50 mg

2,4-D Butyl ester (Standard)

Sign In for Pricing
View Details
2,4-D Butyl ester (Standard)
HY-B0867R-04 100 mg

2,4-D Butyl ester (Standard)

Sign In for Pricing
View Details
PCBP1 (Poly (rC) -binding Protein 1, Alpha-CP1, Heterogeneous Nuclear Ribonucleoprotein E1, hnRNP E1, Nucleic Acid-binding Protein SUB2.3)
218428-01 50 µL

PCBP1 (Poly (rC) -binding Protein 1, Alpha-CP1, Heterogeneous Nuclear Ribonucleoprotein E1, hnRNP E1, Nucleic Acid-binding Protein SUB2.3)

Sign In for Pricing
View Details
PCBP1 (Poly (rC) -binding Protein 1, Alpha-CP1, Heterogeneous Nuclear Ribonucleoprotein E1, hnRNP E1, Nucleic Acid-binding Protein SUB2.3)
218428-02 100 µL

PCBP1 (Poly (rC) -binding Protein 1, Alpha-CP1, Heterogeneous Nuclear Ribonucleoprotein E1, hnRNP E1, Nucleic Acid-binding Protein SUB2.3)

Sign In for Pricing
View Details