Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Fetub protein

This Rat Fetub protein spans the amino acid sequence from region 19-378aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fetuin-like protein IRL685

UniProt

Q9QX79

Expression Region

19-378aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Rattus norvegicus (Rat)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RSPPAPPLPNAPFAPLRPLGCNDSEVLAVAGFALQNINRVQKDGYMLTLNRVHDARVHRQEDMGSLFYLMLDVLETGCHVLSRKALKDCGPRIFYETVHGQCKAMFHVNKPRRVLYLPAYNCTLRPVSKRKIHSMCPDCPHPVDLSAPSVLEAATESLAKFNSENPSKQYALVKVTKATTQWVVGPSYFVEYLIKESPCTQSQDSCSLQASDSEPVGLCQGSLIKSPGVPPQRFKKTVTVSCEFFESQDQVPGGENPADTQDAKKLPQKNTAPTSSPSITAPRGSIQHLPEQEEPEDSKGKSPEEPFPVQLDLTTNPQGDTLDVSFLYLEPEEKKLVVLPFPGKEQRSPECPGPEKQRTP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WDR60 knockout cell line
ABC-KH16929 1 Vial

Human WDR60 knockout cell line

Sign In for Pricing
View Details
Caspase-1/CASP1 Rabbit Polyclonal Antibody (Cy3)
orb2578944 100 µg

Caspase-1/CASP1 Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Anti-Human GST M2-2, Mouse Monoclonal
MBS480803-01 0.1 mg

Anti-Human GST M2-2, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-Human GST M2-2, Mouse Monoclonal
MBS480803-02 5x 0.1 mg

Anti-Human GST M2-2, Mouse Monoclonal

Sign In for Pricing
View Details
NSL1 Antibody, FITC Conjugated
MBS7114304-01 0.05 mg

NSL1 Antibody, FITC Conjugated

Sign In for Pricing
View Details
NSL1 Antibody, FITC Conjugated
MBS7114304-02 0.1 mg

NSL1 Antibody, FITC Conjugated

Sign In for Pricing
View Details