Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial omp protein

This Bacterial omp protein spans the amino acid sequence from region 20-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omp, RJP_094417 kDa surface antigen

UniProt

Q52764

Expression Region

20-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rickettsia japonica (strain ATCC VR-1363 / YH)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4A3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
19148066 1.0 µg DNA

EIF4A3 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
KCNJ12 siRNA (Mouse)
MBS8219734-01 15 nmol

KCNJ12 siRNA (Mouse)

Sign In for Pricing
View Details
KCNJ12 siRNA (Mouse)
MBS8219734-02 30 nmol

KCNJ12 siRNA (Mouse)

Sign In for Pricing
View Details
KCNJ12 siRNA (Mouse)
MBS8219734-03 5x 30 nmol

KCNJ12 siRNA (Mouse)

Sign In for Pricing
View Details
OR6K3 CRISPR All-in-one AAV vector set (with saCas9)(Human)
35514151 3x 1.0 µg DNA

OR6K3 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 750)
MBS6231633-01 0.1 mL

ARNT (Aryl Hydrocarbon Receptor Nuclear Translocator, ARNT Protein, Class E Basic Helix-loop-helix Protein 2, bHLHe2, Dioxin Receptor, Nuclear Translocator, Hypoxia-inducible Factor 1-beta, HIF-1-beta, HIF1-beta, BHLHE2) (MaxLight 750)

Sign In for Pricing
View Details