Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial omp protein

This Bacterial omp protein spans the amino acid sequence from region 20-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Omp, RJP_094417 kDa surface antigen

UniProt

Q52764

Expression Region

20-159aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rickettsia japonica (strain ATCC VR-1363 / YH)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fermt2 Pre-designed siRNA Set B
SI104864B 1 Each

Mouse Fermt2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Olr16 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
34069156 3x 1.0 µg DNA

Olr16 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
ALKBH3 Human qPCR Template Standard (NM_139178)
HK211720 1 Kit

ALKBH3 Human qPCR Template Standard (NM_139178)

Sign In for Pricing
View Details
TSHB discontinued
543401-01 30ul

TSHB discontinued

Sign In for Pricing
View Details
TSHB discontinued
543401-02 100 µL

TSHB discontinued

Sign In for Pricing
View Details
Art1 ORF Vector (Rat) (pORF)
ORF063693 1.0 µg DNA

Art1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details