Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial catA protein

This Bacterial catA protein spans the amino acid sequence from region 1-311aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,2-CTD

UniProt

P07773

Expression Region

1-311aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Acinetobacter baylyi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEVKIFNTQDVQDFLRVASGLEQEGGNPRVKQIIHRVLSDLYKAIEDLNITSDEYWAGVAYLNQLGANQEAGLLSPGLGFDHYLDMRMDAEDAALGIENATPRTIEGPLYVAGAPESVGYARMDDGSDPNGHTLILHGTIFDADGKPLPNAKVEIWHANTKGFYSHFDPTGEQQAFNMRRSIITDENGQYRVRTILPAGYGCPPEGPTQQLLNQLGRHGNRPAHIHYFVSADGHRKLTTQINVAGDPYTYDDFAYATREGLVVDAVEHTDPEAIKANDVEGPFAEMVFDLKLTRLVDGVDNQVVDRPRLAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR37L1 siRNA (Human)
MBS8218161-01 15 nmol

GPR37L1 siRNA (Human)

Sign In for Pricing
View Details
GPR37L1 siRNA (Human)
MBS8218161-02 30 nmol

GPR37L1 siRNA (Human)

Sign In for Pricing
View Details
GPR37L1 siRNA (Human)
MBS8218161-03 5x 30 nmol

GPR37L1 siRNA (Human)

Sign In for Pricing
View Details
ZNF461 Blocking Peptide
MBS9633258-01 1 mg

ZNF461 Blocking Peptide

Sign In for Pricing
View Details
ZNF461 Blocking Peptide
MBS9633258-02 5x 1 mg

ZNF461 Blocking Peptide

Sign In for Pricing
View Details
β-Galactosidase (E. coli) (Agarose)
G1041-05G 500 µL

β-Galactosidase (E. coli) (Agarose)

Sign In for Pricing
View Details