Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PVRL2 protein

This Human PVRL2 protein spans the amino acid sequence from region 32-360aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Herpes virus entry mediator B Short name, Herpesvirus entry mediator B Short name, HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen, CD112

UniProt

Q92692

Expression Region

32-360aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OSBPL11 Mouse Monoclonal Antibody [Clone ID: OTI6H9]
TA501939 100 µL

OSBPL11 Mouse Monoclonal Antibody [Clone ID: OTI6H9]

Sign In for Pricing
View Details
EXOSC1 (NM_016046) Human Over-expression Lysate
LS051013 100 µg

EXOSC1 (NM_016046) Human Over-expression Lysate

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)
MBS2081845-01 0.1 mL

HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)
MBS2081845-02 0.2 mL

HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)
MBS2081845-03 0.5 mL

HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)
MBS2081845-04 1 mL

HRP-Linked Polyclonal Antibody to Phosphoinositide-3-Kinase Catalytic Beta Polypeptide (PIK3Cb)

Sign In for Pricing
View Details