Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EIF3M protein

This Human EIF3M protein spans the amino acid sequence from region 2-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, eIF3m Alternative name (s), Fetal lung protein B5 Short name, hFL-B5 PCI domain-containing protein 1

UniProt

Q7L2H7

Expression Region

2-374aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC8E11.04c Polyclonal Antibody
MBS7140116 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) SPAC8E11.04c Polyclonal Antibody

Sign In for Pricing
View Details
CD300d Polyclonal Antibody
MBS9409459-01 0.05 mL

CD300d Polyclonal Antibody

Sign In for Pricing
View Details
CD300d Polyclonal Antibody
MBS9409459-02 0.1 mL

CD300d Polyclonal Antibody

Sign In for Pricing
View Details
CD300d Polyclonal Antibody
MBS9409459-03 5x 0.1 mL

CD300d Polyclonal Antibody

Sign In for Pricing
View Details
LY 294002
MBS807990-01 5 mg

LY 294002

Sign In for Pricing
View Details
LY 294002
MBS807990-02 25 mg

LY 294002

Sign In for Pricing
View Details