Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AMELX protein

This Human AMELX protein spans the amino acid sequence from region 17-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AI1E, AIH1, ALGN, Amel, Amelogenesis imperfecta 1, Amelogenin (amelogenesis imperfecta 1, X linked), Amelogenin (X chromosome), Amelogenin (X chromosome, amelogenesis imperfecta 1), Amelogenin, Amelogenin X isoform, Amelogenin, X linked, AMELX, AMELX_HUMAN, Amg, AMGL, AMGX, OTTHUMP00000022906, OTTHUMP00000022907, X isoform

UniProt

Q99217

Expression Region

17-191aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Risperidone
C16410-10mM/1mL 10 mM/1mL

Risperidone

Sign In for Pricing
View Details
N-Cbz-4-Aminobutanoic Acid
OR1014318-01 25 g

N-Cbz-4-Aminobutanoic Acid

Sign In for Pricing
View Details
N-Cbz-4-Aminobutanoic Acid
OR1014318-02 100 g

N-Cbz-4-Aminobutanoic Acid

Sign In for Pricing
View Details
N-Cbz-4-Aminobutanoic Acid
OR1014318-03 500 g

N-Cbz-4-Aminobutanoic Acid

Sign In for Pricing
View Details
N-Cbz-4-Aminobutanoic Acid
OR1014318-04 2.5 Kg

N-Cbz-4-Aminobutanoic Acid

Sign In for Pricing
View Details
MYPT1 (Thr852) Antibody
E45R33500G-1 100 µL

MYPT1 (Thr852) Antibody

Sign In for Pricing
View Details