Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AMELX protein

This Human AMELX protein spans the amino acid sequence from region 17-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AI1E, AIH1, ALGN, Amel, Amelogenesis imperfecta 1, Amelogenin (amelogenesis imperfecta 1, X linked), Amelogenin (X chromosome), Amelogenin (X chromosome, amelogenesis imperfecta 1), Amelogenin, Amelogenin X isoform, Amelogenin, X linked, AMELX, AMELX_HUMAN, Amg, AMGL, AMGX, OTTHUMP00000022906, OTTHUMP00000022907, X isoform

UniProt

Q99217

Expression Region

17-191aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLV3-CMV-PGAM5-3xFLAG-Puro Plasmid
PVT85455 2 µg

PLV3-CMV-PGAM5-3xFLAG-Puro Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Padi6 shRNA (UAS) - Lentiviral mouse Padi6 shRNA (UAS, RFP) (100)
GTR15106440 1 Vial

Lentiviral mouse Padi6 shRNA (UAS) - Lentiviral mouse Padi6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
HIST1H2BB CRISPR Knock Out 293T Cell Line (Human)
23336141 1x 10^6 Cells / 1.0 mL

HIST1H2BB CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Human C1S ELISA Kit
SEKH-0701 96 Tests

Human C1S ELISA Kit

Sign In for Pricing
View Details
Lentiviral human VAV1 shRNA (UAS) - Lentiviral human VAV1 shRNA (UAS, iRFP) (100)
GTR15081867 1 Vial

Lentiviral human VAV1 shRNA (UAS) - Lentiviral human VAV1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Mitocondrial Translational Initiation Factor 3 Antibody
orb1319259 100 µL

Mitocondrial Translational Initiation Factor 3 Antibody

Sign In for Pricing
View Details