Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Icos protein

This Rat Icos protein spans the amino acid sequence from region 21-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Activation-inducible lymphocyte immunomediatory molecule CD_antigen, CD278

UniProt

Q9R1T7

Expression Region

21-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ELNDLANHRMFSFHDGGVQISCNYPETVQQLKMQLFKDREVLCDLTKTKGSGNTVSIKNPMSCPYQLSNNSVSFFLDNADSSQGSYFLCSLSIFDPPPFQEKNLSGGYLLIYESQLCCQLKLWLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Rpl26l1 Pre-designed siRNA Set B
SI212141B 1 Each

Rat Rpl26l1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Ku812
ARC0417 1 Million

Ku812

Sign In for Pricing
View Details
Gart (NM_010256) Mouse Recombinant Protein
TP511439 20 µg

Gart (NM_010256) Mouse Recombinant Protein

Sign In for Pricing
View Details
Anti-Procollagen II C-Terminal Propeptide (PIICP)
FY-AB53015-01 1 mL

Anti-Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details
Anti-Procollagen II C-Terminal Propeptide (PIICP)
FY-AB53015-02 100 µL

Anti-Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details
Anti-Procollagen II C-Terminal Propeptide (PIICP)
FY-AB53015-03 200 µL

Anti-Procollagen II C-Terminal Propeptide (PIICP)

Sign In for Pricing
View Details