Human MED1 protein

Activator-recruited cofactor 205KDA component Short name, ARC205 Mediator complex subunit 1 Peroxisome proliferator-activated receptor-binding protein Short name, PBP Short name, PPAR-binding protein Thyroid hormone receptor-associated protein complex 220KDA component Short name, Trap220 Thyroid receptor-interacting protein 2 Short name, TR-interacting protein 2 Short name, TRIP-2 Vitamin D receptor-interacting protein complex component DRIP205 p53 regulatory protein RB18A

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

FGEEYFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPF