Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli mrcA protein

This E. coli mrcA protein spans the amino acid sequence from region 229-529aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, PBP-1a Short name, PBP1a Including the following 2 domains, Penicillin-insensitive transglycosylase Alternative name (s), Peptidoglycan TGase Penicillin-sensitive transpeptidase Alternative name (s), DD-transpeptidase

UniProt

P02918

Expression Region

229-529aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLDEGYITQQQFDQTRTEAINANYHAPEIAFSAPYLSEMVRQEMYNRYGESAYEDGYRIYTTITRKVQQAAQQAVRNNVLDYDMRHGYRGPANVLWKVGESAWDNNKITDTLKALPTYGPLLPAAVTSANPQQATAMLADGSTVALSMEGVRWARPYRSDTQQGPTPRKVTDVLQTGQQIWVRQVGDAWWLAQVPEVNSALVSINPQNGAVMALVGGFDFNQSKFNRATQALRQVGSNIKPFLYTAAMDKGLTLASMLNDVPISRWDASAGSDWQPKNSPPQYAGPIRLRQGLGQSKNVVM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC25A39 antibody
70R-6509 50 ug

SLC25A39 antibody

Sign In for Pricing
View Details
2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone
PC1019923-01 250 mg

2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone
PC1019923-02 500 mg

2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone
PC1019923-03 1 g

2,2,2-trifluoro-1- (2-fluoro-5-methoxy-3- (methylthio) phenyl) ethanone

Sign In for Pricing
View Details
CD49e HC Antibody
MBS8580725-01 0.1 mL

CD49e HC Antibody

Sign In for Pricing
View Details
CD49e HC Antibody
MBS8580725-02 0.1 mL (AF635)

CD49e HC Antibody

Sign In for Pricing
View Details