Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli glpE protein

This E. coli glpE protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlpE, EcolC_0289, Thiosulfate sulfurtransferase GlpE, EC 2.8.1.1

UniProt

B1IP41

Expression Region

1-108aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDQFECINVADAHQKLQEKEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDNDFDTPVMVMCYHGNSSKGAAQYLLQQGYDVVYSIDGGFEVWQRQFPAEVAYGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Olfactory receptor 10AG1 (OR10AG1) ELISA kit
GTR10468807 96 Well

Rabbit Olfactory receptor 10AG1 (OR10AG1) ELISA kit

Sign In for Pricing
View Details
Recombinant Shigella Dysenteriae lolD Protein (aa 1-233)
VAng-Lsx06963-500gEcoli 500 µg (E. coli)

Recombinant Shigella Dysenteriae lolD Protein (aa 1-233)

Sign In for Pricing
View Details
Anti Mouse Ly6A/E(Sca-1) Flow Cytometry Monoclonal Clone D7 PE 100ug
IRTAMSLY6AD7CPE100UG 100 µg

Anti Mouse Ly6A/E(Sca-1) Flow Cytometry Monoclonal Clone D7 PE 100ug

Sign In for Pricing
View Details
PSMA7P sgRNA CRISPR Lentivector (Human) (Target 1)
K1739202 1.0 µg DNA

PSMA7P sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Vegf (Vascular Endothelial Growth Factor A, VEGF-A, Vascular Permeability Factor, Vegfa, VPF) (PE) discontinued
143691-PE 100 µL

Vegf (Vascular Endothelial Growth Factor A, VEGF-A, Vascular Permeability Factor, Vegfa, VPF) (PE) discontinued

Sign In for Pricing
View Details
TGFBI Polyclonal Antibody
E-AB-52170-01 20 µL

TGFBI Polyclonal Antibody

Sign In for Pricing
View Details