Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mgll protein

This Mouse Mgll protein spans the amino acid sequence from region 1-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, MGL Alternative name (s), Monoacylglycerol lipase Short name, MAGL

UniProt

O35678

Expression Region

1-303aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GM2A Antibody (06) [Janelia Fluor 549]
NBP3-06149JF549 0.1 mL

Mouse Monoclonal GM2A Antibody (06) [Janelia Fluor 549]

Sign In for Pricing
View Details
CLIC5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
16344156 3x 1.0 µg DNA

CLIC5 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pis1 Polyclonal Antibody
MBS7188245 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) pis1 Polyclonal Antibody

Sign In for Pricing
View Details
Equine Skin Genomic DNA
GE-101 0.1 mg

Equine Skin Genomic DNA

Sign In for Pricing
View Details
MICA Protein, Human, Recombinant (C-His-Avi)
E51P01790 100 µg

MICA Protein, Human, Recombinant (C-His-Avi)

Sign In for Pricing
View Details
MAPT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28089111 3x 1.0 µg

MAPT sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details