Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mgll protein

This Mouse Mgll protein spans the amino acid sequence from region 1-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, MGL Alternative name (s), Monoacylglycerol lipase Short name, MAGL

UniProt

O35678

Expression Region

1-303aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AFDN Protein
E30P10843 20 µg

Recombinant Human AFDN Protein

Sign In for Pricing
View Details
ATP5F1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
12718061 1.0 µg DNA

ATP5F1P3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Txndc17 Rat Pre-designed siRNA Set A
HY-RS27170 1 Set

Txndc17 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
FBXO41 Human Gene Knockout Kit (CRISPR)
KN422120 1 Kit

FBXO41 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phosphate Buffer pH 7.00 w/ 0.5% Soya Le
LQ195C-10X100ML 1 unit

Phosphate Buffer pH 7.00 w/ 0.5% Soya Le

Sign In for Pricing
View Details
ECE1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV685905 1.0 µg DNA

ECE1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details