Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mgll protein

This Mouse Mgll protein spans the amino acid sequence from region 1-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, MGL Alternative name (s), Monoacylglycerol lipase Short name, MAGL

UniProt

O35678

Expression Region

1-303aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAGCPP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog IgG whole molecule Rhodamine conjugated Protein
OPRA03483-1MG 1 mg

Dog IgG whole molecule Rhodamine conjugated Protein

Sign In for Pricing
View Details
Lentiviral mouse Steap4 shRNA (UAS) - Lentiviral mouse Steap4 shRNA (UAS, iRFP) (25)
GTR15250262 1 Vial

Lentiviral mouse Steap4 shRNA (UAS) - Lentiviral mouse Steap4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral mouse Tsn shRNA (UAS) - Lentiviral mouse Tsn shRNA (UAS, RFP) (25)
GTR15192923 1 Vial

Lentiviral mouse Tsn shRNA (UAS) - Lentiviral mouse Tsn shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Yotiao (AKAP9, PRKA9, CG-NAP) (APC) discontinued
Y2067-APC 100 µL

Yotiao (AKAP9, PRKA9, CG-NAP) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Cell division control protein 45 homolog (sna41), partial
MBS1087638 Inquire

Recombinant Schizosaccharomyces pombe Cell division control protein 45 homolog (sna41), partial

Sign In for Pricing
View Details
Disialoganglioside GD2 (human, brain)
MBS394917 1 mg

Disialoganglioside GD2 (human, brain)

Sign In for Pricing
View Details