Monkey CD3G protein
This Monkey CD3G protein spans the amino acid sequence from region 23-113aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
T-cell receptor T3 gamma chain CD_antigen, CD3g
UniProt
Q95LI7
Expression Region
23-113aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1152565-01 0.02 mg (E-Coli)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details MBS1152565-02 0.02 mg (Yeast)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details MBS1152565-03 0.1 mg (E-Coli)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details MBS1152565-04 0.1 mg (Yeast)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details MBS1152565-05 0.02 mg (Baculovirus)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details MBS1152565-06 0.02 mg (Mammalian-Cell)
Recombinant Proteus vulgaris tRNA-dihydrouridine synthase B (dusB)
Sign In for Pricing
View Details