Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey CD3G protein

This Monkey CD3G protein spans the amino acid sequence from region 23-113aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell receptor T3 gamma chain CD_antigen, CD3g

UniProt

Q95LI7

Expression Region

23-113aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAN12 3'UTR GFP Stable Cell Line
TU076978 1.0 mL

TRNAN12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant COVID-19 S Protein RBD (I341)
MBS8309666-01 0.05 mg

Recombinant COVID-19 S Protein RBD (I341)

Sign In for Pricing
View Details
Recombinant COVID-19 S Protein RBD (I341)
MBS8309666-02 0.5 mg

Recombinant COVID-19 S Protein RBD (I341)

Sign In for Pricing
View Details
Recombinant COVID-19 S Protein RBD (I341)
MBS8309666-03 5x 0.5 mg

Recombinant COVID-19 S Protein RBD (I341)

Sign In for Pricing
View Details
Trpv6 Rabbit Polyclonal Antibody (Biotin)
orb2133686 100 µL

Trpv6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
GSC Rabbit mAb
MBS9147489-01 0.02 mL

GSC Rabbit mAb

Sign In for Pricing
View Details