What is the catalog number for Human FCER1A protein?

The catalog number for Human FCER1A protein is orb383213.

What sizes are available for Human FCER1A protein?

Human FCER1A protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human FCER1A protein come in?

Human FCER1A protein is available in 3 different pack sizes.

Is Human FCER1A protein in stock?

Human FCER1A protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human FCER1A protein

This Human FCER1A protein spans the amino acid sequence from region 26-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fc-epsilon RI-alpha Short name, FcERI IgE Fc receptor subunit alpha

UniProt

P12319

Expression Region

26-205aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ