Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fur protein

This E. coli fur protein spans the amino acid sequence from region 2-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ferric uptake regulator

UniProt

P0A9A9

Expression Region

2-148aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arpp19 qPCR Primer Pair
QM30226S 200 Tests

Mouse Arpp19 qPCR Primer Pair

Sign In for Pricing
View Details
RRM1 Antibody
orb1332522 100 µg

RRM1 Antibody

Sign In for Pricing
View Details
Gm12169 AAV siRNA Pooled Vector
21754164 1.0 µg

Gm12169 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CATSPER Polyclonal Antibody, APC-Cy7 Conjugated
bs-23326R-APC-Cy7 100 µL

CATSPER Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Human GATA Binding Protein 5 (GATA5) ELISA Kit
orb778867-01 48 Tests

Human GATA Binding Protein 5 (GATA5) ELISA Kit

Sign In for Pricing
View Details
Human GATA Binding Protein 5 (GATA5) ELISA Kit
orb778867-02 96 Tests

Human GATA Binding Protein 5 (GATA5) ELISA Kit

Sign In for Pricing
View Details