Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli fur protein

This E. coli fur protein spans the amino acid sequence from region 2-148aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, Ferric uptake regulator

UniProt

P0A9A9

Expression Region

2-148aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAL3ST1 Protein Lysate (Human) with C-Ha Tag
21204031 100 µg

GAL3ST1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Laptm4a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4707906 1.0 µg DNA

Laptm4a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Cst12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV657733 1.0 µg DNA

Cst12 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RNF213 Polyclonal Antibody, Cy7 Conjugated
bs-9840R-Cy7 100 µL

RNF213 Polyclonal Antibody, Cy7 Conjugated

Sign In for Pricing
View Details
TAS2R44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV814611 1.0 µg DNA

TAS2R44 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Nebivolol hydrochloride
M12131-01 1 g

Nebivolol hydrochloride

Sign In for Pricing
View Details