Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial pbpC protein

This Bacterial pbpC protein spans the amino acid sequence from region 21-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PBP 3 Alternative name (s), PSPB20 Penicillin-binding protein C

UniProt

P42971

Expression Region

21-240aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSKTDSPEDRMEAFVKQWNDQQFDDMYQSLTKDVKKEISKKDFVNRYKAIYEQAGVKNLKVTAGEVDKDDQDNKTMKHIPYKVSMNTNAGKVSFKNTAVLKLEKTDDEESWNIDWDPSFIFKQLADDKTVQIMSIEPKRGQIYDKNGKGLAVNTDVPEIGIVPGELGDKKEKVIKELAKKLDLTEDDIKKKLDQGWVKDDSFVPLKKVKPDQEKLVSEAT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAR4 (PAWR) Rabbit Polyclonal Antibody
TA331131 100 µL

PAR4 (PAWR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)
TRV-0035417-01 20 µL

Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)
TRV-0035417-02 100 µL

Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)
TRV-0035417-03 200 µL

Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)

Sign In for Pricing
View Details
Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)
TRV-0035417-04 1 mL

Monoclonal Antibody to Coagulation Factor XIII A1 Polypeptide (F13A1)

Sign In for Pricing
View Details
PPIL5 ORF Vector (Human) (pORF)
37372011 1.0 µg DNA

PPIL5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details