Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hns protein

This Bacterial hns protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone-like protein HLP-II

UniProt

P18955

Expression Region

2-135aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Serratia marcescens

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kallikrein 6 Antibody
orb1248288 0.1 mg

Kallikrein 6 Antibody

Sign In for Pricing
View Details
Centromere Protein Q (CENPQ) Antibody
abx006673-01 60 µL

Centromere Protein Q (CENPQ) Antibody

Sign In for Pricing
View Details
Centromere Protein Q (CENPQ) Antibody
abx006673-02 120 µL

Centromere Protein Q (CENPQ) Antibody

Sign In for Pricing
View Details
Centromere Protein Q (CENPQ) Antibody
abx006673-03 200 µL

Centromere Protein Q (CENPQ) Antibody

Sign In for Pricing
View Details
Human anti centrol and centrosome antibody, ACA ELISA kit
GTR10388291 96 Well

Human anti centrol and centrosome antibody, ACA ELISA kit

Sign In for Pricing
View Details
PRAME (NM_206954) Human Tagged ORF Clone
RG218318 10 µg

PRAME (NM_206954) Human Tagged ORF Clone

Sign In for Pricing
View Details