Bacterial hns protein
This Bacterial hns protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Histone-like protein HLP-II
UniProt
P18955
Expression Region
2-135aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Serratia marcescens
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SERLKILNNIRTLRAQARECTLETLEEMLEKLEVVVNERREEDSQAQAEIEERTRKLQQYREMLIADGIDPNELLQTMAANKAAGKAKRARRPAKYQYKDENGELKTWTGQGRTPAVIKKAIEEQGKSLDDFLL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx128022-01 100 µL
Protein Kinase, AMP Activated Beta 1 (PRKAB1) Antibody
Sign In for Pricing
View Details abx128022-02 200 µL
Protein Kinase, AMP Activated Beta 1 (PRKAB1) Antibody
Sign In for Pricing
View Details abx128022-03 1 mL
Protein Kinase, AMP Activated Beta 1 (PRKAB1) Antibody
Sign In for Pricing
View Details 
orb3007673-01 20 µg
Recombinant Human Laminin subunit gamma-1 (LAMC1), partial
Sign In for Pricing
View Details