Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PVR protein

This Human PVR protein spans the amino acid sequence from region 21-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nectin-like protein 5 Short name, NECL-5 CD_antigen, CD155

UniProt

P15151

Expression Region

21-343aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Thyroid-Peroxidase,TPO ELISA Kit
CN-03917H1 96T

Human Thyroid-Peroxidase,TPO ELISA Kit

Sign In for Pricing
View Details
KCNN2 (NM_021614) Human Untagged Clone
SC310251 10 µg

KCNN2 (NM_021614) Human Untagged Clone

Sign In for Pricing
View Details
PRMT5, CT (Protein Methyltransferase JBP1, Protein Arginine N-methyltransferase 5, Histone-arginine N-methyltransferase PRMT5, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, Jak-binding Protein 1, 72kD ICln-Binding Protein, HRMT1L5, IBP72, JBP1, SKB1) (MaxLight 750) discontinued
P9004-25B-ML750 100 µL

PRMT5, CT (Protein Methyltransferase JBP1, Protein Arginine N-methyltransferase 5, Histone-arginine N-methyltransferase PRMT5, Shk1 Kinase-binding Protein 1 Homolog, SKB1 Homolog, SKB1Hs, Jak-binding Protein 1, 72kD ICln-Binding Protein, HRMT1L5, IBP72, JBP1, SKB1) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans gcy-15 Polyclonal Antibody
MBS9001522 Inquire

Rabbit anti-Caenorhabditis elegans gcy-15 Polyclonal Antibody

Sign In for Pricing
View Details
Mrps7 3'UTR Lenti-reporter-Luc Vector
30605084 1.0 µg

Mrps7 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MKI67IP Antibody
abx123631-01 100 µL

MKI67IP Antibody

Sign In for Pricing
View Details