Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PVR protein

This Human PVR protein spans the amino acid sequence from region 21-343aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nectin-like protein 5 Short name, NECL-5 CD_antigen, CD155

UniProt

P15151

Expression Region

21-343aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP2R5D Recombinant Antibody
bsm-62718R-01 20 µL

PPP2R5D Recombinant Antibody

Sign In for Pricing
View Details
PPP2R5D Recombinant Antibody
bsm-62718R-02 100 µL

PPP2R5D Recombinant Antibody

Sign In for Pricing
View Details
LXN Mouse
32-13306-5 5 µg

LXN Mouse

Sign In for Pricing
View Details
Goat anti-Mouse IgG-Fc Fragment Antibody Biotinylated
MBS3907140-01 1 mg

Goat anti-Mouse IgG-Fc Fragment Antibody Biotinylated

Sign In for Pricing
View Details
Goat anti-Mouse IgG-Fc Fragment Antibody Biotinylated
MBS3907140-02 5x 1 mg

Goat anti-Mouse IgG-Fc Fragment Antibody Biotinylated

Sign In for Pricing
View Details
PCDHA2, NT (PCDHA2, Protocadherin alpha-2) (AP) discontinued
039731-AP 200 µL

PCDHA2, NT (PCDHA2, Protocadherin alpha-2) (AP) discontinued

Sign In for Pricing
View Details