Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RETNLB protein

This Human RETNLB protein spans the amino acid sequence from region 24-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Colon and small intestine-specific cysteine-rich protein Colon carcinoma-related gene protein Cysteine-rich secreted protein A12-alpha-like 1 Cysteine-rich secreted protein FIZZ2 RELMbeta

UniProt

Q9BQ08

Expression Region

24-111aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1A1L (CK1, Casein Kinase I Isoform alpha-like) (MaxLight 405)
MBS6445903-01 0.1 mL

CSNK1A1L (CK1, Casein Kinase I Isoform alpha-like) (MaxLight 405)

Sign In for Pricing
View Details
CSNK1A1L (CK1, Casein Kinase I Isoform alpha-like) (MaxLight 405)
MBS6445903-02 5x 0.1 mL

CSNK1A1L (CK1, Casein Kinase I Isoform alpha-like) (MaxLight 405)

Sign In for Pricing
View Details
NELFe Rabbit Polyclonal Antibody (PE-Cy5)
orb946892 100 µL

NELFe Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
AS3MT Blocking Peptide
MBS9632617-01 1 mg

AS3MT Blocking Peptide

Sign In for Pricing
View Details
AS3MT Blocking Peptide
MBS9632617-02 5x 1 mg

AS3MT Blocking Peptide

Sign In for Pricing
View Details
2,2,6,6-Tetramethyl-4-[ (triphenylphosphoranylidene) amino]-1-piperidinyloxy
MBS6106826-01 100 mg

2,2,6,6-Tetramethyl-4-[ (triphenylphosphoranylidene) amino]-1-piperidinyloxy

Sign In for Pricing
View Details