Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SEMG1 protein

This Human SEMG1 protein spans the amino acid sequence from region 24-402aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cancer/testis antigen 103 Semenogelin I Short name, SGI Cleaved into the following 3 chains, Alpha-inhibin-92 Alpha-inhibin-31 Seminal basic protein

UniProt

P04279

Expression Region

24-402aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Leptin Receptor (LEPR) ELISA Kit
BSKP65490-01 48 Tests

Porcine Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Porcine Leptin Receptor (LEPR) ELISA Kit
BSKP65490-02 96 Tests

Porcine Leptin Receptor (LEPR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal Ferritin Antibody
NBP1-31944 0.1 mL

Rabbit Polyclonal Ferritin Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Complement C7 Antibody (009) [Alexa Fluor 700]
NBP2-90243AF700 0.1 mL

Rabbit Monoclonal Complement C7 Antibody (009) [Alexa Fluor 700]

Sign In for Pricing
View Details
SUN3 Protein Lysate
OCOA15938-20UG 20 µg

SUN3 Protein Lysate

Sign In for Pricing
View Details
Phospho-CDK9 (Thr186) Antibody
MBS9613241-01 0.05 mL

Phospho-CDK9 (Thr186) Antibody

Sign In for Pricing
View Details