Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog CTSK protein

This Dog CTSK protein spans the amino acid sequence from region 116-330aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CTSK, Cathepsin K, EC 3.4.22.38

UniProt

Q3ZKN1

Expression Region

116-330aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPISVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOXA (F-3) : m-IgG1 BP-HRP Bundle
sc-544610 1 Kit

NOXA (F-3) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Sall4 (NM_201395) Mouse Tagged ORF Clone Lentiviral Particle
MR226826L3V 200 µL

Sall4 (NM_201395) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RRP8 Rabbit pAb
MBS9143732-01 0.02 mL

RRP8 Rabbit pAb

Sign In for Pricing
View Details
RRP8 Rabbit pAb
MBS9143732-02 0.1 mL

RRP8 Rabbit pAb

Sign In for Pricing
View Details
RRP8 Rabbit pAb
MBS9143732-03 5x 0.1 mL

RRP8 Rabbit pAb

Sign In for Pricing
View Details
Mouse Monoclonal CXCL1/2/3/GRO Antibody (29702) [DyLight 350]
FAB2761D 0.1 mL

Mouse Monoclonal CXCL1/2/3/GRO Antibody (29702) [DyLight 350]

Sign In for Pricing
View Details