Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER1A protein

This Human FCER1A protein spans the amino acid sequence from region 26-205aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-epsilon RI-alpha Short name, FcERI IgE Fc receptor subunit alpha

UniProt

P12319

Expression Region

26-205aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DEFB118 Human Gene Knockout Kit (CRISPR)
KN421558 1 Kit

DEFB118 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rat CRP Recombinant Rabbit monoclonal Antibody
HA725051B 100 µL

Rat CRP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1-Bromopropane-d7
TRC-B687138-50MG 50 mg

1-Bromopropane-d7

Sign In for Pricing
View Details
Ammonium Persulfate (APS), 100g
PR0605-100g 100 g

Ammonium Persulfate (APS), 100g

Sign In for Pricing
View Details
Cyb5r3 (C-term) Goat Polyclonal Antibody
AP23661PU-N 100 µg

Cyb5r3 (C-term) Goat Polyclonal Antibody

Sign In for Pricing
View Details
6-Amino-3-isopropyl pyrimidine-2,4(1H,3H)-dione
TRC-A299830-50MG 50 mg

6-Amino-3-isopropyl pyrimidine-2,4(1H,3H)-dione

Sign In for Pricing
View Details