Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial uspA protein

This Bacterial uspA protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

UspA, STY4212, t3925, Universal stress protein A

UniProt

Q8Z268

Expression Region

2-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Salmonella typhi

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AYKHILIAVDLSPESKVLVEKAVSMARPYNAKISLIHVDVNYSDLYTGLIDVNLGDMQKRISKETHHALTELSTNAGYPITETLSGSGDLGQVLVDAIKKYDMDLVVCGHHQDFWSKLMSSARQLINTVHVDMLIVPLRDEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human MYOZ1 Polyclonal Antibody
HP233014-01 50 µg

Anti-Human MYOZ1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human MYOZ1 Polyclonal Antibody
HP233014-02 100 µg

Anti-Human MYOZ1 Polyclonal Antibody

Sign In for Pricing
View Details
CCDC82 Rabbit Polyclonal Antibody (APC)
orb992878 100 µL

CCDC82 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
RPS6P19 3'UTR Luciferase Stable Cell Line
TU021849 1.0 mL

RPS6P19 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
DNA2 Antibody; FITC conjugated
MBS7005902-01 0.05 mg

DNA2 Antibody; FITC conjugated

Sign In for Pricing
View Details
DNA2 Antibody; FITC conjugated
MBS7005902-02 0.1 mg

DNA2 Antibody; FITC conjugated

Sign In for Pricing
View Details