Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial omcB protein

This Bacterial omcB protein spans the amino acid sequence from region 41-196aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Large-CRP Alternative name (s), 60KDA cysteine-rich OMP Short name, 60KDA CRP 60KDA outer membrane protein Cysteine-rich outer membrane protein

UniProt

P23700

Expression Region

41-196aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Chlamydia pneumoniae (Chlamydophila pneumoniae)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITGB3 Rabbit Polyclonal Antibody (BF350)
orb1602219 100 µL

ITGB3 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RAB8A Rabbit Polyclonal Antibody (FITC)
orb2080962 100 µL

RAB8A Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
OR4N3P 3'UTR Luciferase Stable Cell Line
TU016554 1.0 mL

OR4N3P 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
UCP1 Polyclonal Antibody
MBS8532236-01 0.1 mg

UCP1 Polyclonal Antibody

Sign In for Pricing
View Details
UCP1 Polyclonal Antibody
MBS8532236-02 0.1 mL (AF635)

UCP1 Polyclonal Antibody

Sign In for Pricing
View Details
UCP1 Polyclonal Antibody
MBS8532236-03 0.1 mL (AF610)

UCP1 Polyclonal Antibody

Sign In for Pricing
View Details