Bacterial omcB protein
This Bacterial omcB protein spans the amino acid sequence from region 41-196aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Large-CRP Alternative name (s), 60KDA cysteine-rich OMP Short name, 60KDA CRP 60KDA outer membrane protein Cysteine-rich outer membrane protein
UniProt
P23700
Expression Region
41-196aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Chlamydia pneumoniae (Chlamydophila pneumoniae)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
33.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SAETKPAPVPMTAKKVRLVRRNKQPVEQKSRGAFCDKEFYPCEEGRCQPVEAQQESCYGRLYSVKVNDDCNVEICQSVPEYATVGSPYPIEILAIGKKDCVDVVITQQLPCEAEFVSSDPETTPTSDGKLVWKIDRLGAGDKCKITVWVKPLKEGC
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1587904 100 µL
NADPH oxidase 4 Rabbit Polyclonal Antibody (BF350)
Sign In for Pricing
View Details ![SPIB Antibody [F10D9]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
MBS1120243-01 0.02 mg (E-Coli)
Recombinant Cucumber green mottle mosaic virus Movement protein (MP)
Sign In for Pricing
View Details MBS1120243-02 0.02 mg (Yeast)
Recombinant Cucumber green mottle mosaic virus Movement protein (MP)
Sign In for Pricing
View Details