What is the catalog number for Insect D7 protein?

The catalog number for Insect D7 protein is orb383174.

What sizes are available for Insect D7 protein?

Insect D7 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Insect D7 protein come in?

Insect D7 protein is available in 3 different pack sizes.

Is Insect D7 protein in stock?

Insect D7 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Insect D7 protein

This Insect D7 protein spans the amino acid sequence from region 18-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alternative name (s), Protein D7 Allergen, Aed a 2

UniProt

P18153

Expression Region

18-321aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Aedes aegypti (Yellowfever mosquito) (Culex aegypti)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ