Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLEC4C protein

This Human CLEC4C protein spans the amino acid sequence from region 45-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Blood dendritic cell antigen 2 Short name, BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen, CD303

UniProt

Q8WTT0

Expression Region

45-213aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CDCA3 Antibody [Alexa Fluor 488]
NB100-74621AF488 0.1 mL

Rabbit Polyclonal CDCA3 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
AQP7P4 sgRNA CRISPR Lentivector (Human) (Target 2)
K0110003 1.0 µg DNA

AQP7P4 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lincomycin test strips
PRS0017 96 Tests

Lincomycin test strips

Sign In for Pricing
View Details
Phactr3 (NM_001177791) Mouse Tagged Lenti ORF Clone
MR219774L4 10 µg

Phactr3 (NM_001177791) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HLA-DRA discontinued
389999-01 20 µL

HLA-DRA discontinued

Sign In for Pricing
View Details
HLA-DRA discontinued
389999-02 200 µL

HLA-DRA discontinued

Sign In for Pricing
View Details