Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CLEC4C protein

This Human CLEC4C protein spans the amino acid sequence from region 45-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Blood dendritic cell antigen 2 Short name, BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen, CD303

UniProt

Q8WTT0

Expression Region

45-213aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Valosin Containing Protein (VCP)
MBS2029245-01 0.01 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details
Recombinant Valosin Containing Protein (VCP)
MBS2029245-02 0.05 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details
Recombinant Valosin Containing Protein (VCP)
MBS2029245-03 0.1 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details
Recombinant Valosin Containing Protein (VCP)
MBS2029245-04 0.2 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details
Recombinant Valosin Containing Protein (VCP)
MBS2029245-05 0.5 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details
Recombinant Valosin Containing Protein (VCP)
MBS2029245-06 1 mg

Recombinant Valosin Containing Protein (VCP)

Sign In for Pricing
View Details