Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hspX protein

This Bacterial hspX protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

16KDA antigen HSP 16.3

UniProt

P0A5B8

Expression Region

2-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human NBPF5 Polyclonal Antibody
PA89226HU-01 50 µg

Rabbit Anti-Human NBPF5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human NBPF5 Polyclonal Antibody
PA89226HU-02 100 µg

Rabbit Anti-Human NBPF5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human NBPF5 Polyclonal Antibody
PA89226HU-03 500 µg

Rabbit Anti-Human NBPF5 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human NBPF5 Polyclonal Antibody
PA89226HU-04 1 mg

Rabbit Anti-Human NBPF5 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-97 (nhr-97)
MBS1352972-01 0.02 mg (E-Coli)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-97 (nhr-97)

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-97 (nhr-97)
MBS1352972-02 0.02 mg (Yeast)

Recombinant Caenorhabditis elegans Nuclear hormone receptor family member nhr-97 (nhr-97)

Sign In for Pricing
View Details