Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial hspX protein

This Bacterial hspX protein spans the amino acid sequence from region 2-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

16KDA antigen HSP 16.3

UniProt

P0A5B8

Expression Region

2-144aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATTLPVQRHPRSLFPEFSELFAAFPSFAGLRPTFDTRLMRLEDEMKEGRYEVRAELPGVDPDKDVDIMVRDGQLTIKAERTEQKDFDGRSEFAYGSFVRTVSLPVGADEDDIKATYDKGILTVSVAVSEGKPTEKHIQIRSTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calsequestrin 1 antibody
70R-12860 100 ul

Calsequestrin 1 antibody

Sign In for Pricing
View Details
AdmiRa-hsa-mir-4657 Virus
mh1328 250 µL

AdmiRa-hsa-mir-4657 Virus

Sign In for Pricing
View Details
Ddr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3824907 1.0 µg DNA

Ddr2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Phospho-Lyn (Tyr507) Rabbit pAb
E47R3256 100 µL

Phospho-Lyn (Tyr507) Rabbit pAb

Sign In for Pricing
View Details
Disecting Instrument Kit
4010410 1 Each

Disecting Instrument Kit

Sign In for Pricing
View Details
Rabbit MVP/Major Vault Protein Antibody
orb1521513-01 10 µL

Rabbit MVP/Major Vault Protein Antibody

Sign In for Pricing
View Details