Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant MALD1 protein

This Plant MALD1 protein spans the amino acid sequence from region 2-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Mal d I Allergen, Mal d 1

UniProt

P43211

Expression Region

2-159aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Malus domestica (Apple) (Pyrus malus)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

α-Adaptin 1 (C-5) Alexa Fluor® 790
sc-398024 AF790 200 µg/mL

α-Adaptin 1 (C-5) Alexa Fluor® 790

Sign In for Pricing
View Details
Caspase 3 (BSA & Azide Free) (CPP-32, Apoptain, Yama, SCA-1) (HRP) discontinued
C2087-22C4X-HRP 100 µL

Caspase 3 (BSA & Azide Free) (CPP-32, Apoptain, Yama, SCA-1) (HRP) discontinued

Sign In for Pricing
View Details
Rabbit Anti-CYP7A1 antibody
SL2399R-01 50 µL

Rabbit Anti-CYP7A1 antibody

Sign In for Pricing
View Details
Rabbit Anti-CYP7A1 antibody
SL2399R-02 100 µL

Rabbit Anti-CYP7A1 antibody

Sign In for Pricing
View Details
RAF1 (BRAF) (T598) Rabbit pAb
E2620089 100 µL

RAF1 (BRAF) (T598) Rabbit pAb

Sign In for Pricing
View Details
Metabotropic Glutamate Receptor 3 (GRM3) (NM_000840) Human Tagged ORF Clone Lentiviral Particle
RC207379L4V 200 µL

Metabotropic Glutamate Receptor 3 (GRM3) (NM_000840) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details