Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D. discoideum ponA protein

This D. discoideum ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PonA, DDB_G0293522, Ponticulin

UniProt

P54660

Expression Region

23-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1R,2S,5R)-(-)-Menthol
TRC-M218875-5G 5 g

(1R,2S,5R)-(-)-Menthol

Sign In for Pricing
View Details
AMHR2 (NM_020547) Human Recombinant Protein
TP312425M 100 µg

AMHR2 (NM_020547) Human Recombinant Protein

Sign In for Pricing
View Details
HSV1 (Herpes Simplex Virus Type I) (N/A), CF488A conjugate, 0.1mg/mL
BNC881800-500 1x 500 µL

HSV1 (Herpes Simplex Virus Type I) (N/A), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nr2c2ap (NM_001025587) Mouse Tagged ORF Clone
MG200500 10 µg

Nr2c2ap (NM_001025587) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Psmb10 Mouse Gene Knockout Kit (CRISPR)
KN514098 1 Kit

Psmb10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS710478 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details