Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D. discoideum ponA protein

This D. discoideum ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PonA, DDB_G0293522, Ponticulin

UniProt

P54660

Expression Region

23-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASRGL1 Antibody
CSB-PA002233GA01HU 100 µL

ASRGL1 Antibody

Sign In for Pricing
View Details
PAWR (PAR4) discontinued
512515 100 µg

PAWR (PAR4) discontinued

Sign In for Pricing
View Details
TUBB2C, ID (TUBB4B, TUBB2C, Tubulin beta-4B chain, Tubulin beta-2 chain, Tubulin beta-2C chain) (MaxLight 490) discontinued
043455-ML490 100 µL

TUBB2C, ID (TUBB4B, TUBB2C, Tubulin beta-4B chain, Tubulin beta-2 chain, Tubulin beta-2C chain) (MaxLight 490) discontinued

Sign In for Pricing
View Details
GPM6A Antibody Blocking peptide
orb1457773 500 µg

GPM6A Antibody Blocking peptide

Sign In for Pricing
View Details
LPAR3 Rabbit Polyclonal Antibody (Fluoro550)
orb3101573 100 µg

LPAR3 Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
TC-A 2317 hydrochloride
A4489-50 50 mg

TC-A 2317 hydrochloride

Sign In for Pricing
View Details