Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

D. discoideum ponA protein

This D. discoideum ponA protein spans the amino acid sequence from region 23-118aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PonA, DDB_G0293522, Ponticulin

UniProt

P54660

Expression Region

23-118aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYTLSVSNSASGSKCTTAVSAKLNACNTGCLNSFNIVESSNGKGLVFKTFINAACSGEYESLSQFTCAANQKIPTTSYIVSCNSTPSSNSTTDSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL
BNC742316-500 1x 500 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Rat CD71 Antibody[OX-26]
AN00622E-01 50 Tests

APC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
APC Anti-Rat CD71 Antibody[OX-26]
AN00622E-02 100 Tests

APC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
APC Anti-Rat CD71 Antibody[OX-26]
AN00622E-03 2x 100 Tests

APC Anti-Rat CD71 Antibody[OX-26]

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG76e), CF647 conjugate, 0.1mg/mL
BNC471687-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG76e), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GLP-2 (Glucagon Like Peptide 2) ELISA Kit
E-EL-H2238-01 24 Tests

Human GLP-2 (Glucagon Like Peptide 2) ELISA Kit

Sign In for Pricing
View Details