Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral LMP2 protein

This Viral LMP2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Terminal protein

UniProt

P13285

Expression Region

1-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-B2M-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit for Endothelin 2 (EDN2)
TRV-0004660-01 24 Tests

ELISA Kit for Endothelin 2 (EDN2)

Sign In for Pricing
View Details
ELISA Kit for Endothelin 2 (EDN2)
TRV-0004660-02 48 Tests

ELISA Kit for Endothelin 2 (EDN2)

Sign In for Pricing
View Details
ELISA Kit for Endothelin 2 (EDN2)
TRV-0004660-03 96 Tests

ELISA Kit for Endothelin 2 (EDN2)

Sign In for Pricing
View Details
ELISA Kit for Endothelin 2 (EDN2)
TRV-0004660-04 5x 96 Tests

ELISA Kit for Endothelin 2 (EDN2)

Sign In for Pricing
View Details
ELISA Kit for Endothelin 2 (EDN2)
TRV-0004660-05 10x 96 Tests

ELISA Kit for Endothelin 2 (EDN2)

Sign In for Pricing
View Details
Lentiviral mouse Thrb shRNA (UAS) - Lentiviral mouse Thrb shRNA (UAS, GFP) (100)
GTR15293868 1 Vial

Lentiviral mouse Thrb shRNA (UAS) - Lentiviral mouse Thrb shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details