Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral LMP2 protein

This Viral LMP2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Terminal protein

UniProt

P13285

Expression Region

1-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-B2M-tagged Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSLEMVPMGAGPPSPGGDPDGYDGGNNSQYPSASGSSGNTPTPPNDEERESNEEPPPPYEDPYWGNGDRHSDYQPLGTQDQSLYLGLQHDGNDGLPPPPYSPRDDSSQHIYEEAGRGSMNPVCLPVIVAPYLFWLAAIAASCFTAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Il1a Pre-designed siRNA Set A
SI106625A 1 Each

Mouse Il1a Pre-designed siRNA Set A

Sign In for Pricing
View Details
Olr1291 (NM_001000797) Rat Tagged ORF Clone
RR209528 10 µg

Olr1291 (NM_001000797) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Fibrillarin (FBL) Monkey ELISA Kit
D3737 96 Tests

Fibrillarin (FBL) Monkey ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal PARL Antibody [Alexa Fluor 350]
NBP1-76938AF350 0.1 mL

Rabbit Polyclonal PARL Antibody [Alexa Fluor 350]

Sign In for Pricing
View Details
ATP6AP1L CRISPRa sgRNA lentivector (set of three targets)(Mouse)
12766124 3x 1.0µg DNA

ATP6AP1L CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Human Cardiac Troponin-T
MBS142897-01 0.01 mg

Human Cardiac Troponin-T

Sign In for Pricing
View Details