Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial yopM protein

This Bacterial yopM protein spans the amino acid sequence from region 1-409aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YopM, yop48, YPCD1.26c, y5054, y0059, YP_pCD60, Outer membrane protein YopM

UniProt

P17778

Expression Region

1-409aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Yersinia pestis

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

62.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nanobacteria Removal Complete Medium (10) (MEM)
PM150411B-HR 100 mL

Nanobacteria Removal Complete Medium (10) (MEM)

Sign In for Pricing
View Details
C14orf28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
13853111 3x 1.0 µg

C14orf28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PCMV-GOLGA7-3xFLAG-Neo Plasmid
PVT67421 2 µg

PCMV-GOLGA7-3xFLAG-Neo Plasmid

Sign In for Pricing
View Details
C1QTNF7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K0220906 1.0 µg DNA

C1QTNF7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Piretanide
TRC-P508700-1MG 1 mg

Piretanide

Sign In for Pricing
View Details
LIM1 Antibody
orb1335049 100 µg

LIM1 Antibody

Sign In for Pricing
View Details