Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NAT2 protein

This Human NAT2 protein spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Arylamide acetylase 2 N-acetyltransferase type 2 Short name, NAT-2 Polymorphic arylamine N-acetyltransferase Short name, PNAT

UniProt

P11245

Expression Region

1-290aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PRF1 Protein Lysate 20ug
IHUPRF1PLLY20UG 20 µg

Human PRF1 Protein Lysate 20ug

Sign In for Pricing
View Details
GDF7 (Growth Differentiation Factor 7, BMP12)
246548 100 µg

GDF7 (Growth Differentiation Factor 7, BMP12)

Sign In for Pricing
View Details
N1- (3-Aminophenyl) acetamide
T7253-01 1 g

N1- (3-Aminophenyl) acetamide

Sign In for Pricing
View Details
N1- (3-Aminophenyl) acetamide
T7253-02 5 g

N1- (3-Aminophenyl) acetamide

Sign In for Pricing
View Details
Il13ra2 Mouse Pre-designed siRNA Set A
HY-RS18438 1 Set

Il13ra2 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Agmatine Ureohydrolase (AGMAT)
MBS2081576-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Agmatine Ureohydrolase (AGMAT)

Sign In for Pricing
View Details