Human NAT2 protein
This Human NAT2 protein spans the amino acid sequence from region 1-290aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Arylamide acetylase 2 N-acetyltransferase type 2 Short name, NAT-2 Polymorphic arylamine N-acetyltransferase Short name, PNAT
UniProt
P11245
Expression Region
1-290aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
49.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-SUMO-tagged Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLVPKPGDGSLTI
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
358889-01 48 Tests
Slc18a3 (Vesicular acetylcholine transporter) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 358889-02 96 Tests
Slc18a3 (Vesicular acetylcholine transporter) BioAssayTM ELISA Kit (Rat) discontinued
Sign In for Pricing
View Details 
MBS553922-01 0.05 mg
Biotinylated Human MSLN/Mesothelin Protein Recombinant
Sign In for Pricing
View Details MBS553922-02 0.25 mg
Biotinylated Human MSLN/Mesothelin Protein Recombinant
Sign In for Pricing
View Details MBS553922-03 5x 0.25 mg
Biotinylated Human MSLN/Mesothelin Protein Recombinant
Sign In for Pricing
View Details