Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Clec4e protein

This Mouse Clec4e protein spans the amino acid sequence from region 46-214aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-type lectin superfamily member 9 Macrophage-inducible C-type lectin

UniProt

Q9R0Q8

Expression Region

46-214aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNA Antibody
orb837949 2 mg

TRNA Antibody

Sign In for Pricing
View Details
TIGD1
CSB-CL839377HU 10 μg Plasmid + 200 μL Glycerol

TIGD1

Sign In for Pricing
View Details
2,4-Dichloro-5-methoxyaniline hydrochloride
EQA22930 25 g

2,4-Dichloro-5-methoxyaniline hydrochloride

Sign In for Pricing
View Details
Ras-Related protein Rab-27A (RAB27A) Mouse ELISA Kit
G6556 96 Tests

Ras-Related protein Rab-27A (RAB27A) Mouse ELISA Kit

Sign In for Pricing
View Details
PLXNA2 Antibody
MBS7044941-01 0.05 mL

PLXNA2 Antibody

Sign In for Pricing
View Details
PLXNA2 Antibody
MBS7044941-02 0.1 mL

PLXNA2 Antibody

Sign In for Pricing
View Details