Mouse Clec4e protein
This Mouse Clec4e protein spans the amino acid sequence from region 46-214aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
C-type lectin superfamily member 9 Macrophage-inducible C-type lectin
UniProt
Q9R0Q8
Expression Region
46-214aa
Tag
N-terminal 6xHis-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
23.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
E.coli and Yeast N-terminal 6xHis-tagged Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TYRSSQISGQNLQPHRNIKELSCYSEASGSVKNCCPLNWKHYQSSCYFFSTTTLTWSSSLKNCSDMGAHLVVIDTQEEQEFLFRTKPKRKEFYIGLTDQVVEGQWQWVDDTPFTESLSFWDAGEPNNIVLVEDCATIRDSSNSRKNWNDIPCFYSMPWICEMPEISPLD
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7221571-01 48 Well
Mouse COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details MBS7221571-02 96 Well
Mouse COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details MBS7221571-03 5x 96 Well
Mouse COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details MBS7221571-04 10x 96 Well
Mouse COP9 signalosome complex subunit 1 (GPS1) ELISA Kit
Sign In for Pricing
View Details 
CSB-EL025541RA-01 48 Tests
Rat Ubiquitin carboxyl-terminal hydrolase isozyme L1 (UCHL1) ELISA kit
Sign In for Pricing
View Details